PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr002548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 352aa    MW: 39815.2 Da    PI: 4.7847
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr002548.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.64e-5661331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v s +
  Pbr002548.1   6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVSS-Q 101
                  79****************************.99**************96435566888*************************************9.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +++vg+kktLv+y+grap+g +t+Wvmheyrl
  Pbr002548.1 102 SRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                  99****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-643157IPR003441NAC domain
PROSITE profilePS5100560.8456157IPR003441NAC domain
PfamPF023655.6E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVSS QSRAVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVDSVCAN ASSSLKDSYA LCRVFKKTIQ MPQNNKEEKP VGINNADKDS  180
IWVSNEQLFG KENSGINEGA SRGIETDQDG NYSNHDYPKF PSDTSSSDLT QGTPTENGIA  240
DDLQAPFTSD EANSSADLYS FGVHCSSDLI QETYIPHNTS VLNSYQFPYP PLQLEDFPQI  300
NLAAETKTAK PEIIDEYMLY DKFKGYMNGT FEEIFSLCSS QDNSVALSMQ D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-61115712165NO APICAL MERISTEM PROTEIN
1ut4_B4e-61115712165NO APICAL MERISTEM PROTEIN
1ut7_A4e-61115712165NO APICAL MERISTEM PROTEIN
1ut7_B4e-61115712165NO APICAL MERISTEM PROTEIN
3swm_A5e-61115715168NAC domain-containing protein 19
3swm_B5e-61115715168NAC domain-containing protein 19
3swm_C5e-61115715168NAC domain-containing protein 19
3swm_D5e-61115715168NAC domain-containing protein 19
3swp_A5e-61115715168NAC domain-containing protein 19
3swp_B5e-61115715168NAC domain-containing protein 19
3swp_C5e-61115715168NAC domain-containing protein 19
3swp_D5e-61115715168NAC domain-containing protein 19
4dul_A4e-61115712165NAC domain-containing protein 19
4dul_B4e-61115712165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363322.10.0PREDICTED: NAC domain-containing protein 19-like
TrEMBLM5WNI40.0M5WNI4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18180.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-109NAC domain containing protein 20